PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0233s0110.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 287aa    MW: 32660.8 Da    PI: 5.9931
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0233s0110.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.72.8e-50101381129
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lppGfrF P+deelv++yL+kk++++++    ++ e+d++++ePw+Lp+ ++ + +ewyfFs rd+kyatg r+nrat++gyWkatg
  SapurV1A.0233s0110.1.p  10 LPPGFRFYPSDEELVCHYLHKKITNEEVLK-GTLVEIDLHTCEPWQLPEVARLNATEWYFFSFRDRKYATGFRTNRATTTGYWKATG 95 
                             79************************9655.78***************87777899******************************* PP

                     NAM  88 kdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrle 129
                             kd++vl+  ++e+vg++ktLvfy++rap+g kt W+mhe+rle
  SapurV1A.0233s0110.1.p  96 KDRTVLDPtTREVVGMRKTLVFYRNRAPNGIKTGWIMHEFRLE 138
                             *******977888***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.67E-608156IPR003441NAC domain
PROSITE profilePS5100557.60410156IPR003441NAC domain
PfamPF023651.4E-2711137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MGLRDIGATL PPGFRFYPSD EELVCHYLHK KITNEEVLKG TLVEIDLHTC EPWQLPEVAR  60
LNATEWYFFS FRDRKYATGF RTNRATTTGY WKATGKDRTV LDPTTREVVG MRKTLVFYRN  120
RAPNGIKTGW IMHEFRLETP HMHPKEDWVL CRVFHKCRAE DYNAKFSPQF MLEATANSGT  180
VNLAASPLSD HQTLACGYQQ MPSLSSSPTP PHQNQDQSSL LNLLQLSQAR NANPNASTDT  240
NSKALDEYGF LWDEMSLEET SLGDGVLASD LEDMRFEIDH NSMVFI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D1e-47915619168NAC domain-containing protein 19
3swp_C1e-47915619168NAC domain-containing protein 19
3swp_B1e-47915619168NAC domain-containing protein 19
3swp_A1e-47915619168NAC domain-containing protein 19
3swm_D1e-47915619168NAC domain-containing protein 19
3swm_C1e-47915619168NAC domain-containing protein 19
3swm_B1e-47915619168NAC domain-containing protein 19
3swm_A1e-47915619168NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002307652.10.0hypothetical protein POPTR_0005s24750g
SwissprotQ84TE64e-63NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLB9H8N90.0B9H8N9_POPTR; Uncharacterized protein
STRINGGLYMA13G18620.21e-134(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43813359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.11e-91NAC domain containing protein 74